Loading...
Statistics
Advertisement

Shamanic Artwork By Carmella Weintraub | Paintings, Mandalas ...
www.shamanicart.com/
The artwork of Carmella Weintraub. Shamanic Art including paintings, mandalas, ceremonial gowns, and poetry.

Shamanicart.com

Advertisement
Conversion Technology Metas Server
Shamanicart.com is hosted in United States / Scottsdale . Shamanicart.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Html, Javascript, Number of used javascripts: 8. First javascripts: L10n.js, Shutter-reloaded.js, Jquery.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Number of used plugins, modules: 2. Its server type is: Apache/2.4.23. Its CMS is: Wordpress.

Technologies in use by Shamanicart.com

Technology

Number of occurences: 8
  • CSS
  • Html
  • Javascript
  • jQuery
  • jQuery Cycle
  • Php
  • Pingback
  • SuperFish

Advertisement

Javascripts

Number of occurences: 8
  • l10n.js
  • shutter-reloaded.js
  • jquery.js
  • jquery.cycle.all.min.js
  • ngg.slideshow.min.js
  • superfish.js
  • superfish.args.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache/2.4.23

Powered by

  • PHP/5.4.45

Used plugins, modules

Number of plugins and modules: 2
  • nextgen gallery
  • wp cycle

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Shamanicart.com

SSL certificate

    • name: /OU=Domain Control Validated/CN=campcatwalkdesignandsewingacademy.com
    • subject:
      • OU: Domain Control Validated
      • CN: campcatwalkdesignandsewingacademy.com
    • hash: c79cb9de
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 6407017128336913741
    • validFrom: 150421210241Z
    • validTo: 180421210241Z
    • validFrom_time_t: 1429650161
    • validTo_time_t: 1524344561
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-87.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:campcatwalkdesignandsewingacademy.com, DNS:www.campcatwalkdesignandsewingacademy.com, DNS:carmelladoro.com, DNS:shamanicart.com, DNS:www.carmelladoro.com, DNS:www.shamanicart.com
      • subjectKeyIdentifier: D1:F1:C8:2A:10:F3:03:8B:83:D6:4C:CB:51:62:42:A5:99:BA:B5:72

Meta - Shamanicart.com

Number of occurences: 4
  • Name:
    Content: text/html; charset=UTF-8
  • Name: description
    Content: The artwork of Carmella Weintraub. Shamanic Art including paintings, mandalas, ceremonial gowns, and poetry.
  • Name: robots
    Content: noodp,noydir
  • Name: NextGEN
    Content: 1.7.4

Server / Hosting

  • IP: 160.153.86.105
  • Latitude: 33.61
  • Longitude: -111.89
  • Country: United States
  • City: Scottsdale

Rname

  • ns70.domaincontrol.com
  • ns69.domaincontrol.com
  • mail.shamanicart.com

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 04 Sep 2016 05:43:15 GMT Server: Apache/2.4.23 X-Powered-By: PHP/5.4.45 X-Pingback: http://www.shamanicart.com/xmlrpc.php Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Transfer-Encoding: chunked Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

DNS

host: shamanicart.com
  1. class: IN
  2. ttl: 599
  3. type: A
  4. ip: 160.153.86.105
host: shamanicart.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns70.domaincontrol.com
host: shamanicart.com
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns69.domaincontrol.com
host: shamanicart.com
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns69.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016050400
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: shamanicart.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: mail.shamanicart.com
host: shamanicart.com
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 a mx ptr include:secureserver.net ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hamanicart.com, www.sehamanicart.com, www.ehamanicart.com, www.swhamanicart.com, www.whamanicart.com, www.sdhamanicart.com, www.dhamanicart.com, www.sxhamanicart.com, www.xhamanicart.com, www.sfhamanicart.com, www.fhamanicart.com, www.sghamanicart.com, www.ghamanicart.com, www.sthamanicart.com, www.thamanicart.com, www.samanicart.com, www.sheamanicart.com, www.seamanicart.com, www.shdamanicart.com, www.sdamanicart.com, www.shcamanicart.com, www.scamanicart.com, www.shuamanicart.com, www.suamanicart.com, www.shjamanicart.com, www.sjamanicart.com, www.shamanicart.com, www.samanicart.com, www.shbamanicart.com, www.sbamanicart.com, www.shgamanicart.com, www.sgamanicart.com, www.shmanicart.com, www.shaomanicart.com, www.shomanicart.com, www.shapmanicart.com, www.shpmanicart.com, www.sha9manicart.com, www.sh9manicart.com, www.shamanicart.com, www.shmanicart.com, www.shaimanicart.com, www.shimanicart.com, www.shaumanicart.com, www.shumanicart.com, www.shaanicart.com, www.shampanicart.com, www.shapanicart.com, www.shamoanicart.com, www.shaoanicart.com, www.shamianicart.com, www.shaianicart.com, www.shamkanicart.com, www.shakanicart.com, www.sham.anicart.com, www.sha.anicart.com, www.shamuanicart.com, www.shauanicart.com, www.shamjanicart.com, www.shajanicart.com, www.shamnanicart.com, www.shananicart.com, www.sham-anicart.com, www.sha-anicart.com, www.shamnicart.com, www.shamaonicart.com, www.shamonicart.com, www.shamapnicart.com, www.shampnicart.com, www.shama9nicart.com, www.sham9nicart.com, www.shamanicart.com, www.shamnicart.com, www.shamainicart.com, www.shaminicart.com, www.shamaunicart.com, www.shamunicart.com, www.shamaicart.com, www.shamannicart.com, www.shamanicart.com, www.shamanhicart.com, www.shamahicart.com, www.shamanjicart.com, www.shamajicart.com, www.shamankicart.com, www.shamakicart.com, www.shamanlicart.com, www.shamalicart.com, www.shaman icart.com, www.shama icart.com, www.shamancart.com, www.shamanircart.com, www.shamanrcart.com, www.shamanifcart.com, www.shamanfcart.com, www.shamanivcart.com, www.shamanvcart.com, www.shamanikcart.com, www.shamankcart.com, www.shamani,cart.com, www.shaman,cart.com, www.shamanibcart.com, www.shamanbcart.com, www.shamanigcart.com, www.shamangcart.com, www.shamanitcart.com, www.shamantcart.com, www.shamaniycart.com, www.shamanycart.com, www.shamaniucart.com, www.shamanucart.com, www.shamanijcart.com, www.shamanjcart.com, www.shamanimcart.com, www.shamanmcart.com, www.shamanincart.com, www.shamanncart.com, www.shamaniart.com, www.shamanicdart.com, www.shamanidart.com, www.shamanicrart.com, www.shamanirart.com, www.shamanictart.com, www.shamanitart.com, www.shamanicvart.com, www.shamanivart.com, www.shamanicfart.com, www.shamanifart.com, www.shamanicgart.com, www.shamanigart.com, www.shamanichart.com, www.shamanihart.com, www.shamanicnart.com, www.shamaninart.com, www.shamanicmart.com, www.shamanimart.com, www.shamanicjart.com, www.shamanijart.com, www.shamanicrt.com, www.shamanicaort.com, www.shamanicort.com, www.shamanicaprt.com, www.shamanicprt.com, www.shamanica9rt.com, www.shamanic9rt.com, www.shamanicart.com, www.shamanicrt.com, www.shamanicairt.com, www.shamanicirt.com, www.shamanicaurt.com, www.shamanicurt.com, www.shamanicat.com, www.shamanicarit.com, www.shamanicait.com, www.shamanicarot.com, www.shamanicaot.com, www.shamanicarlt.com, www.shamanicalt.com, www.shamanicarlt.com, www.shamanicalt.com, www.shamanicar.t.com, www.shamanica.t.com,

Other websites we recently analyzed

  1. rentingdc.com
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. www.eastbank.com.cn
    Denver (United States) - 198.148.92.50
    Server software: nginx
    Technology: Html, Iframe
    Number of meta tags: 1
  3. gleecon.com.py
    Houston (United States) - 192.232.223.9
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 8
    Number of meta tags: 4
  4. Domov pod Kuňkou
    Domov pod Kuňkou
    Czech Republic - 109.205.75.39
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 8
    Number of meta tags: 5
  5. Restaurants and Dining Guide | Restaurants Reviews | Restaurants Listing - www.macon-ga.restaurants800.com
    www.macon-ga.restaurants800.com is one of the most popular and comprehensive restaurants and dining guide for restaurants and food courts in . If you are based in or travelling to we will help you in getting the complete list of Restaurants and Hotels in . Keep updated of all the restaurants,Hotels, eating houses, Chinese restaurants, fast food places, food courts and dining reviews as well as restaurant reviews. If you are a business owner you can contact us to submit your business and get it listed in our restaurants and dining guide. Browse or search thousands of restaurant listings only at www.macon-ga.restaurants800.com.
    Secaucus (United States) - 66.23.238.61
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 5
  6. jane-postlethwaite.com
    Dublin (Ireland) - 54.154.168.70
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
    Number of Javascript: 4
    Number of meta tags: 2
  7. ea官网
    ea官网,提供ea官网,是值得信任的娱乐品牌，用心打造一个公平，公正，公开的娱乐平台。
    Kwun Tong (Hong Kong) - 123.60.194.143
    Server software: nginx
    Technology: Html, Javascript, jQuery Validate
    Number of Javascript: 9
    Number of meta tags: 4
  8. Home Page
    Home Page
    Scottsdale (United States) - 97.74.144.133
    Server software: Apache
    Technology: CSS, Html, Javascript, Google Analytics
    Number of Javascript: 1
    Number of meta tags: 4
  9. Restaurantbetriebe.de
    Germany - 88.198.231.4
    Server software: Apache/2.4.10 (Debian)
    Technology: CSS, Html, Html5, Javascript, jQuery
    Number of Javascript: 15
    Number of meta tags: 4
  10. Komerc KEKA
    Podgorica (Montenegro) - 213.149.103.135
    Server software: Apache
    Technology: CSS, Html, Javascript, StatCounter
    Number of Javascript: 1
    Number of meta tags: 3

Check Other Websites